Gene
| Gene Model ID | pfu_aug2.0_2528.1_28846 |
|---|---|
| Locus | scaffold2528.1 : 88936 ... 93315 : + |
| To GenomeBrowser | scaffold2528.1:88936..93315 |
| Genes list of scaffold | scaffold2528.1 |
| Synonym | pfu_aug1.0_18.1_14706 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_2528.1_28846.t1 | 1 | 1 | Tubulin | 1 | 75 | 2.2e-23 | 83.1 | 4.9e-27 | 2.4e-23 | 83.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_2528.1_28846.t1 | gi|612040923|ref|XP_007499784.1| | PREDICTED: tubulin beta chain-like isoform X1 [Monodelphis domestica] | 4.0e-24 |
| pfu_aug2.0_2528.1_28846.t1 | gi|196002007|ref|XP_002110871.1| | hypothetical protein TRIADDRAFT_54235 [Trichoplax adhaerens] | 4.0e-24 |
| pfu_aug2.0_2528.1_28846.t1 | gi|573896127|ref|XP_006635805.1| | PREDICTED: tubulin beta chain, nucleomorph-like [Lepisosteus oculatus] | 2.0e-23 |
| pfu_aug2.0_2528.1_28846.t1 | gi|698779907|ref|XP_009822997.1| | hypothetical protein H257_01472 [Aphanomyces astaci] | 4.0e-23 |
| pfu_aug2.0_2528.1_28846.t1 | gi|591384111|ref|XP_007066513.1| | PREDICTED: tubulin delta chain-like [Chelonia mydas] | 1.0e-22 |
Transcript
| Transcript ID | pfu_aug2.0_2528.1_28846.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2528.1_28846.t1 atggaaaaagtcagaaaggaaatagagctgtgtgatgcttacagtgggtgtgttgtcatgcatagtctgtctgggggaac tggctcaggacttgggtccaagctgatagagatgttacgagaccagtatcccatgaaccacctgatgtcctgtacgtttg caccacatgccagtggggagagcccactccaaaactacaatgcattactaacactctcaatattacaaag |
|
Protein
| Protein ID | pfu_aug2.0_2528.1_28846.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2528.1_28846.t1 MEKVRKEIELCDAYSGCVVMHSLSGGTGSGLGSKLIEMLRDQYPMNHLMSCTFAPHASGESPLQNYNALLTLSILQ |
|