Gene
| Gene Model ID | pfu_aug2.0_254.1_13882 |
|---|---|
| Locus | scaffold254.1 : 205410 ... 211920 : + |
| To GenomeBrowser | scaffold254.1:205410..211920 |
| Genes list of scaffold | scaffold254.1 |
| Synonym | pfu_aug1.0_9516.1_60614 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| charged multivesicular body protein partial | GO:0007034 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_254.1_13882.t1 | 2 | 1 | Snf7 | 4 | 168 | 1.2e-37 | 128.8 | 5.79997e-41 | 1.2e-37 | 128.8 |
| pfu_aug2.0_254.1_13882.t1 | 2 | 2 | Snf7 | 187 | 202 | 1.2e-37 | 128.8 | 0.26 | 560.0 | -0.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_254.1_13882.t1 | gi|676450325|ref|XP_009052342.1| | hypothetical protein LOTGIDRAFT_214378 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_254.1_13882.t1 | gi|701295944|ref|XP_010008173.1| | PREDICTED: charged multivesicular body protein 3, partial [Nestor notabilis] | 0.0 |
| pfu_aug2.0_254.1_13882.t1 | gi|700356000|ref|XP_009922345.1| | PREDICTED: charged multivesicular body protein 3, partial [Haliaeetus albicilla] | 0.0 |
| pfu_aug2.0_254.1_13882.t1 | gi|729723504|ref|XP_010576116.1| | PREDICTED: charged multivesicular body protein 3 isoform X4 [Haliaeetus leucocephalus] | 0.0 |
| pfu_aug2.0_254.1_13882.t1 | gi|699653252|ref|XP_009880818.1| | PREDICTED: charged multivesicular body protein 3 [Charadrius vociferus] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_254.1_13882.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_254.1_13882.t1 atggtcaatgaatggacacacaaaataagaaaggaaggatatgtcttggatagacaaataagaagtatacaaagagagga agaaaaagtacggagacagataaaagactcggccaaaaaaggagaaaaagaggcatgcaaaatcctggccaaagaggtaa tcaggtctaggaaggctgtcaacagactctacgcatctaaagcacacatgaactcagtacagatgagcatgaaaaatcaa ttagcgaccttaaggatagctggagctcttgaaaagagtactgaggtcatgaacagtatgcaggctttaatcaaaatacc cgaaatacaatccacaatgagggagatgtctaaagaaatgatgaaggctggtattcttgaggaaatgttagatgacacaa tggaatcattagatgatgatgagttagatgatgaagctgatgaggcagtagaagcagtcataatggaactaacaacaggt gagctgaagaaagccccattacctatgcaggactccttggctgtgccggaggatgagggtgcaactgcactgccggcaga tgaagaagaagacgaagatctcacaaaccgattagaagctctacggagctga |
|
Protein
| Protein ID | pfu_aug2.0_254.1_13882.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_254.1_13882.t1 MVNEWTHKIRKEGYVLDRQIRSIQREEEKVRRQIKDSAKKGEKEACKILAKEVIRSRKAVNRLYASKAHMNSVQMSMKNQ LATLRIAGALEKSTEVMNSMQALIKIPEIQSTMREMSKEMMKAGILEEMLDDTMESLDDDELDDEADEAVEAVIMELTTG ELKKAPLPMQDSLAVPEDEGATALPADEEEDEDLTNRLEALRS |
|