Gene
| Gene Model ID | pfu_aug2.0_2822.1_08991 |
|---|---|
| Locus | scaffold2822.1 : 4417 ... 10925 : - |
| To GenomeBrowser | scaffold2822.1:4417..10925 |
| Genes list of scaffold | scaffold2822.1 |
| Synonym | pfu_aug1.0_1391.1_07932 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| mitochondrial 2-oxoglutarate malate carrier protein | GO:0005634 GO:0005743 GO:0006839 GO:0016021 GO:0044822 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_2822.1_08991.t1 | 1 | 1 | Mito_carr | 1 | 83 | 1.5e-19 | 69.5 | 1.1e-23 | 1.7e-19 | 69.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_2822.1_08991.t1 | gi|524868832|ref|XP_005091215.1| | PREDICTED: mitochondrial 2-oxoglutarate/malate carrier protein-like isoform X1 [Aplysia californica] | 0.0 |
| pfu_aug2.0_2822.1_08991.t1 | gi|676467869|ref|XP_009058027.1| | hypothetical protein LOTGIDRAFT_209667 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_2822.1_08991.t1 | gi|318056060|ref|NP_001188019.1| | mitochondrial 2-oxoglutarate/malate carrier protein [Ictalurus punctatus] | 7.00649e-45 |
| pfu_aug2.0_2822.1_08991.t1 | gi|675850370|ref|XP_009010745.1| | hypothetical protein HELRODRAFT_104748 [Helobdella robusta] | 1.96182e-44 |
| pfu_aug2.0_2822.1_08991.t1 | gi|699237719|ref|XP_009862380.1| | PREDICTED: mitochondrial 2-oxoglutarate/malate carrier protein [Ciona intestinalis] | 1.96182e-44 |
Transcript
| Transcript ID | pfu_aug2.0_2822.1_08991.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2822.1_08991.t1 atgatcagcggtcttgttactaccatagcgtccatgcctgtagatattgctaaaactagaatacagaatatgaaaatgat agatggagtacctgagtacaaaggggcactggatgttctaacgaaggtgatacgtaacgagggtttcttcagtttatgga aaggattcctgccgtactatttccgcctcggacctcatacggtgttaacgtttatatttttagaacagatgaacaagtat tacgctcgatatgtactaaaagacgcttcggcctcagttaagaagcaccctgaccctacttaa |
|
Protein
| Protein ID | pfu_aug2.0_2822.1_08991.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2822.1_08991.t1 MISGLVTTIASMPVDIAKTRIQNMKMIDGVPEYKGALDVLTKVIRNEGFFSLWKGFLPYYFRLGPHTVLTFIFLEQMNKY YARYVLKDASASVKKHPDPT |
|