Gene
| Gene Model ID | pfu_aug2.0_2905.1_18968 |
|---|---|
| Locus | scaffold2905.1 : 77056 ... 77847 : + |
| To GenomeBrowser | scaffold2905.1:77056..77847 |
| Genes list of scaffold | scaffold2905.1 |
| Synonym | pfu_aug1.0_93989.1_71423 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| histone h2a-like | GO:0000786 GO:0003677 GO:0005634 GO:0046982 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_2905.1_18968.t1 | 1 | 1 | Histone | 17 | 90 | 1.9e-25 | 88.7 | 3.3e-29 | 2.4e-25 | 88.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_2905.1_18968.t1 | gi|662194070|ref|XP_008469968.1| | PREDICTED: histone H2A-like [Diaphorina citri] | 0.0 |
| pfu_aug2.0_2905.1_18968.t1 | gi|196012824|ref|XP_002116274.1| | conserved hypothetical protein [Trichoplax adhaerens] | 0.0 |
| pfu_aug2.0_2905.1_18968.t1 | gi|391344251|ref|XP_003746415.1| | PREDICTED: histone H2A-like, partial [Metaseiulus occidentalis] | 0.0 |
| pfu_aug2.0_2905.1_18968.t1 | gi|391340816|ref|XP_003744732.1| | PREDICTED: histone H2A-like [Metaseiulus occidentalis] | 0.0 |
| pfu_aug2.0_2905.1_18968.t1 | gi|391344346|ref|XP_003746462.1| | PREDICTED: histone H2A-like [Metaseiulus occidentalis] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_2905.1_18968.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2905.1_18968.t1 atgtctggaagaggtaaaggtggaaaggcaaagtctaaagccaaatcccgatcatcaagggcaggacttcaattccctgt tggaaggatccatcgtctcttgcgcaaggggaactactcagagagagtcggagcaggtgctccggtttacctggccgctg tattggagtatctggccgccgaggtactggaactggcgggcaatgcagcaagggataacaagaaaagcagaatcattcct cgccatcttcagctagccattaggaatgacgaggagctgaacaaattgctgcatggagtgaccatcgcccaaggaggagt cctaccaaacatccaagctgtcctacttccaaaaaaggcaggtagcactaagggaaaaccaagccagagccaagagtact ag |
|
Protein
| Protein ID | pfu_aug2.0_2905.1_18968.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2905.1_18968.t1 MSGRGKGGKAKSKAKSRSSRAGLQFPVGRIHRLLRKGNYSERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIP RHLQLAIRNDEELNKLLHGVTIAQGGVLPNIQAVLLPKKAGSTKGKPSQSQEY |
|