Gene
| Gene Model ID | pfu_aug2.0_3026.1_22265 |
|---|---|
| Locus | scaffold3026.1 : 49598 ... 64925 : - |
| To GenomeBrowser | scaffold3026.1:49598..64925 |
| Genes list of scaffold | scaffold3026.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| protein mms22-like | GO:0006974 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_3026.1_22265.t1 | 1 | 1 | MMS22L_C | 2 | 140 | 8.4e-21 | 74.4 | 6.4e-25 | 9.5e-21 | 74.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_3026.1_22265.t1 | gi|676461414|ref|XP_009055936.1| | hypothetical protein LOTGIDRAFT_232683 [Lottia gigantea] | 7.0e-28 |
| pfu_aug2.0_3026.1_22265.t1 | gi|585720856|ref|XP_006813162.1| | PREDICTED: protein MMS22-like [Saccoglossus kowalevskii] | 5.0e-20 |
| pfu_aug2.0_3026.1_22265.t1 | gi|260791528|ref|XP_002590781.1| | hypothetical protein BRAFLDRAFT_78196 [Branchiostoma floridae] | 4.0e-19 |
| pfu_aug2.0_3026.1_22265.t1 | gi|733879293|ref|XP_010705884.1| | PREDICTED: protein MMS22-like [Meleagris gallopavo] | 4.0e-10 |
| pfu_aug2.0_3026.1_22265.t1 | gi|591358580|ref|XP_007052851.1| | PREDICTED: protein MMS22-like [Chelonia mydas] | 5.0e-10 |
Transcript
| Transcript ID | pfu_aug2.0_3026.1_22265.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_3026.1_22265.t1 atgttaaacctagaggatgtgaggtcgatatttctggcaggtgacatggacttaccgactgagtcggacaccagggcttt ctttcatttcttgaaggccatacaggcagctcatactaaaattcagggatggaaggagagaatagagctgagagataaag taatgcagtatttctgtgatgtaccgagactgatatcacccgtaatacagagcttacagcccagtgatgtactcagtaat gtgtatgctgtagtcggttatatcgtcaagtgctgtgccccacttatatttatagagtccaaaccagactgtcccttacc cagcctgattaatagtatggttgtgcctcataccctgctcaacacagagaaggctgttagccctgtcttcctgaatgtag taagagaacatttacatcagcaagacaagaatagcttattttcttga |
|
Protein
| Protein ID | pfu_aug2.0_3026.1_22265.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_3026.1_22265.t1 MLNLEDVRSIFLAGDMDLPTESDTRAFFHFLKAIQAAHTKIQGWKERIELRDKVMQYFCDVPRLISPVIQSLQPSDVLSN VYAVVGYIVKCCAPLIFIESKPDCPLPSLINSMVVPHTLLNTEKAVSPVFLNVVREHLHQQDKNSLFS |
|