Gene
| Gene Model ID | pfu_aug2.0_320.1_00596 |
|---|---|
| Locus | scaffold320.1 : 34106 ... 38048 : + |
| To GenomeBrowser | scaffold320.1:34106..38048 |
| Genes list of scaffold | scaffold320.1 |
| Synonym | pfu_aug1.0_3293.1_23287 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| s-adenosylmethionine synthase isoform type-1 | GO:0004478 GO:0005524 GO:0005829 GO:0006556 GO:0006730 GO:0046872 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_320.1_00596.t1 | 1 | 1 | S-AdoMet_synt_C | 1 | 74 | 1.1e-32 | 112.6 | 8.1e-37 | 1.2e-32 | 112.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_320.1_00596.t1 | gi|260802572|ref|XP_002596166.1| | hypothetical protein BRAFLDRAFT_57135 [Branchiostoma floridae] | 3.0e-38 |
| pfu_aug2.0_320.1_00596.t1 | gi|562871705|ref|XP_006163807.1| | PREDICTED: S-adenosylmethionine synthase isoform type-1 isoform X2 [Tupaia chinensis] | 4.0e-38 |
| pfu_aug2.0_320.1_00596.t1 | gi|562871707|ref|XP_006163808.1| | PREDICTED: S-adenosylmethionine synthase isoform type-1 isoform X3 [Tupaia chinensis] | 4.0e-38 |
| pfu_aug2.0_320.1_00596.t1 | gi|562871703|ref|XP_006163806.1| | PREDICTED: S-adenosylmethionine synthase isoform type-1 isoform X1 [Tupaia chinensis] | 5.0e-38 |
| pfu_aug2.0_320.1_00596.t1 | gi|675428003|ref|XP_008927896.1| | PREDICTED: S-adenosylmethionine synthase isoform type-1 [Manacus vitellinus] | 6.0e-38 |
Transcript
| Transcript ID | pfu_aug2.0_320.1_00596.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_320.1_00596.t1 atgcaggtgtcatatgccattggtatttctgaacccatttccatcacagtgttcagctacggcacatcaaaattatcaga aaaggaattactagctgttgtaaagaagaatttcgacttaagacctggagtcattgtgaaggagttgaacttgagagcac caatctaccaaaagacagcatgctacggacatttcggacgaccagatttcccctgggaacagccaaagaaacttgttgtt tag |
|
Protein
| Protein ID | pfu_aug2.0_320.1_00596.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_320.1_00596.t1 MQVSYAIGISEPISITVFSYGTSKLSEKELLAVVKKNFDLRPGVIVKELNLRAPIYQKTACYGHFGRPDFPWEQPKKLVV |
|