Gene
| Gene Model ID | pfu_aug2.0_33.1_10151 |
|---|---|
| Locus | scaffold33.1 : 597635 ... 604373 : - |
| To GenomeBrowser | scaffold33.1:597635..604373 |
| Genes list of scaffold | scaffold33.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| bardet-biedl syndrome 10 protein homolog isoform x1 | GO:0005488 GO:0009987 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_33.1_10151.t1 | 1 | 1 | Cpn60_TCP1 | 20 | 84 | 1.5e-12 | 46.9 | 1.1e-16 | 1.7e-12 | 46.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_33.1_10151.t1 | gi|260819004|ref|XP_002604672.1| | hypothetical protein BRAFLDRAFT_127427 [Branchiostoma floridae] | 4.0e-13 |
| pfu_aug2.0_33.1_10151.t1 | gi|573891809|ref|XP_006633661.1| | PREDICTED: Bardet-Biedl syndrome 10 protein homolog [Lepisosteus oculatus] | 7.0e-12 |
| pfu_aug2.0_33.1_10151.t1 | gi|676493566|ref|XP_009066280.1| | hypothetical protein LOTGIDRAFT_169741 [Lottia gigantea] | 1.0e-11 |
| pfu_aug2.0_33.1_10151.t1 | gi|498994653|ref|XP_004553301.1| | PREDICTED: Bardet-Biedl syndrome 10 protein isoform X3 [Maylandia zebra] | 2.0e-11 |
| pfu_aug2.0_33.1_10151.t1 | gi|511858365|ref|XP_004752435.1| | PREDICTED: Bardet-Biedl syndrome 10 protein isoform X1 [Mustela putorius furo] | 2.0e-11 |
Transcript
| Transcript ID | pfu_aug2.0_33.1_10151.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_33.1_10151.t1 atggagagaaggtccaaaactgtgaacgttgggagcatatcagatgtaacaagagtcatagaaaatctccttaccagtgg atttggtcctcaaggaaagcacactctgatgtcgacatcaactgggcaagtgatggtcacaaatcacggagctgtcatac tgaactcgctacattttgctcatccaataactagagtcgttcttgacgcagtaaacaagacggtatctttcactggagac ggatgtaaaactttttga |
|
Protein
| Protein ID | pfu_aug2.0_33.1_10151.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_33.1_10151.t1 MERRSKTVNVGSISDVTRVIENLLTSGFGPQGKHTLMSTSTGQVMVTNHGAVILNSLHFAHPITRVVLDAVNKTVSFTGD GCKTF |
|