Gene
| Gene Model ID | pfu_aug2.0_4.1_13332 |
|---|---|
| Locus | scaffold4.1 : 429572 ... 436110 : - |
| To GenomeBrowser | scaffold4.1:429572..436110 |
| Genes list of scaffold | scaffold4.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| gtp:amp phosphotransferase mitochondrial | GO:0009117 GO:0016772 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_4.1_13332.t1 | 2 | 1 | ADK | 2 | 36 | 1.3e-10 | 41.3 | 6.6e-07 | 0.0049 | 16.7 |
| pfu_aug2.0_4.1_13332.t1 | 2 | 2 | ADK | 32 | 68 | 1.3e-10 | 41.3 | 2.4e-09 | 1.8e-05 | 24.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_4.1_13332.t1 | gi|676436309|ref|XP_009047840.1| | hypothetical protein LOTGIDRAFT_230595 [Lottia gigantea] | 9.0e-32 |
| pfu_aug2.0_4.1_13332.t1 | gi|524897639|ref|XP_005105279.1| | PREDICTED: GTP:AMP phosphotransferase AK3, mitochondrial-like [Aplysia californica] | 2.0e-30 |
| pfu_aug2.0_4.1_13332.t1 | gi|564238457|ref|XP_006276098.1| | PREDICTED: GTP:AMP phosphotransferase AK3, mitochondrial [Alligator mississippiensis] | 8.0e-28 |
| pfu_aug2.0_4.1_13332.t1 | gi|557285324|ref|XP_006025466.1| | PREDICTED: GTP:AMP phosphotransferase AK3, mitochondrial isoform X1 [Alligator sinensis] | 2.0e-27 |
| pfu_aug2.0_4.1_13332.t1 | gi|347921114|ref|NP_998295.2| | GTP:AMP phosphotransferase AK3, mitochondrial [Danio rerio] | 1.0e-26 |
Transcript
| Transcript ID | pfu_aug2.0_4.1_13332.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_4.1_13332.t1 atggtggatctcatccttaatgaactacacaaggtggagaaacatagctggttattggatggattcccccgtaccgggaa agatgacataacaggtgaagagttaatacaacgagatgatgacaagccagaaaccgttagtaaacgtttggagaactacc aaaatcttacgcagccagtattagatttctacaggtctcatggagtacttgaggaattcacggggagatattccaatgaa ctttggcctcaggttcataagtttctagccaccaagatagagcccatccagtatacacactaccaataa |
|
Protein
| Protein ID | pfu_aug2.0_4.1_13332.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_4.1_13332.t1 MVDLILNELHKVEKHSWLLDGFPRTGKDDITGEELIQRDDDKPETVSKRLENYQNLTQPVLDFYRSHGVLEEFTGRYSNE LWPQVHKFLATKIEPIQYTHYQ |
|