Gene
| Gene Model ID | pfu_aug2.0_401.1_04114 |
|---|---|
| Locus | scaffold401.1 : 216004 ... 224150 : - |
| To GenomeBrowser | scaffold401.1:216004..224150 |
| Genes list of scaffold | scaffold401.1 |
| Synonym | pfu_aug1.0_11941.1_03150 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| homeodomain-only protein | GO:0044238 GO:0044260 GO:0045595 GO:0048513 GO:0048523 GO:0051094 GO:0051239 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_401.1_04114.t1 | 1 | 1 | Homeobox | 22 | 71 | 5.8e-08 | 32.2 | 1.1e-11 | 7.9e-08 | 31.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_401.1_04114.t1 | gi|291234524|ref|XP_002737197.1| | PREDICTED: homeodomain-only protein-like [Saccoglossus kowalevskii] | 5.0e-17 |
| pfu_aug2.0_401.1_04114.t1 | gi|551512666|ref|XP_005807847.1| | PREDICTED: homeodomain-only protein-like [Xiphophorus maculatus] | 5.0e-16 |
| pfu_aug2.0_401.1_04114.t1 | gi|586475085|ref|XP_006868105.1| | PREDICTED: homeodomain-only protein [Chrysochloris asiatica] | 2.0e-15 |
| pfu_aug2.0_401.1_04114.t1 | gi|657572649|ref|XP_008289949.1| | PREDICTED: homeodomain-only protein [Stegastes partitus] | 2.0e-15 |
| pfu_aug2.0_401.1_04114.t1 | gi|657796754|ref|XP_008325409.1| | PREDICTED: homeodomain-only protein [Cynoglossus semilaevis] | 3.0e-15 |
Transcript
| Transcript ID | pfu_aug2.0_401.1_04114.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_401.1_04114.t1 atgtcagtaagtaatagcagtatacaagcacaattgacccccgctcagcagctccccagggtacgggcggagcaggaaaa ggttttggaggctaatttccaacagaatcgtaaccccacggacctggatgtaacactgattgcagcggaggcagggctat ctgaggacgaaactaaaaaatggtatcgccatcgtttggcgtgttggcgacagcagcagggacttcccgccaatagtggc tccgttatggactag |
|
Protein
| Protein ID | pfu_aug2.0_401.1_04114.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_401.1_04114.t1 MSVSNSSIQAQLTPAQQLPRVRAEQEKVLEANFQQNRNPTDLDVTLIAAEAGLSEDETKKWYRHRLACWRQQQGLPANSG SVMD |
|