Gene
| Gene Model ID | pfu_aug2.0_4124.1_15926 |
|---|---|
| Locus | scaffold4124.1 : 17936 ... 23459 : + |
| To GenomeBrowser | scaffold4124.1:17936..23459 |
| Genes list of scaffold | scaffold4124.1 |
| Synonym | pfu_aug1.0_4097.1_16286 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| gamma-aminobutyric acid receptor-associated protein | GO:0006914 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_4124.1_15926.t1 | 1 | 1 | Atg8 | 13 | 116 | 0.0 | 163.6 | 0.0 | 0.0 | 163.4 |
| pfu_aug2.0_4124.1_15926.t1 | 1 | 1 | APG12 | 38 | 116 | 3.4e-07 | 30.3 | 5.6e-11 | 4.2e-07 | 30.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_4124.1_15926.t1 | gi|676467926|ref|XP_009058046.1| | hypothetical protein LOTGIDRAFT_182626 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_4124.1_15926.t1 | gi|156387826|ref|XP_001634403.1| | predicted protein [Nematostella vectensis] | 0.0 |
| pfu_aug2.0_4124.1_15926.t1 | gi|524889167|ref|XP_005101144.1| | PREDICTED: gamma-aminobutyric acid receptor-associated protein-like [Aplysia californica] | 0.0 |
| pfu_aug2.0_4124.1_15926.t1 | gi|260793226|ref|XP_002591613.1| | hypothetical protein BRAFLDRAFT_122660 [Branchiostoma floridae] | 0.0 |
| pfu_aug2.0_4124.1_15926.t1 | gi|284005106|ref|NP_001164700.1| | GABA(A) receptor-associated protein [Saccoglossus kowalevskii] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_4124.1_15926.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_4124.1_15926.t1 atgaagtgggaatacaaagaagaacatccttttgagaaaaggagagccgaaggagagaagataaggaaaaaatacccaga cagagtccccgtcattgttgagaaagcaccaaaggctcgagtgggtgatttggacaagaagaagtacttggtgccatcag atttaactgtaggacagttttacttccttataaggaagagaatccatctgcgaccagaagatgcgttattcttctttgtt aataatgtgattcctccaaccagcgccacaatgggttccctttatcaggagcaccatgaagaggatttctttttgtacat agcctacagtgatgagagtgtatacggagcataa |
|
Protein
| Protein ID | pfu_aug2.0_4124.1_15926.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_4124.1_15926.t1 MKWEYKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKARVGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV NNVIPPTSATMGSLYQEHHEEDFFLYIAYSDESVYGA |
|