Gene
| Gene Model ID | pfu_aug2.0_426.1_20761 |
|---|---|
| Locus | scaffold426.1 : 220457 ... 230255 : - |
| To GenomeBrowser | scaffold426.1:220457..230255 |
| Genes list of scaffold | scaffold426.1 |
| Synonym | pfu_aug1.0_22986.1_04259 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_426.1_20761.t1 | 1 | 1 | DUF2615 | 1 | 100 | 5.8e-37 | 125.7 | 4.30002e-41 | 6.3e-37 | 125.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_426.1_20761.t1 | gi|676484720|ref|XP_009063432.1| | hypothetical protein LOTGIDRAFT_195608 [Lottia gigantea] | 2.0e-37 |
| pfu_aug2.0_426.1_20761.t1 | gi|675873088|ref|XP_009022104.1| | hypothetical protein HELRODRAFT_185806 [Helobdella robusta] | 6.0e-32 |
| pfu_aug2.0_426.1_20761.t1 | gi|291229647|ref|XP_002734784.1| | PREDICTED: small integral membrane protein 14-like [Saccoglossus kowalevskii] | 8.0e-31 |
| pfu_aug2.0_426.1_20761.t1 | gi|632944098|ref|XP_007887313.1| | PREDICTED: small integral membrane protein 14 [Callorhinchus milii] | 3.0e-29 |
| pfu_aug2.0_426.1_20761.t1 | gi|148539926|ref|NP_001016053.2| | small integral membrane protein 14 [Xenopus (Silurana) tropicalis] | 3.0e-27 |
Transcript
| Transcript ID | pfu_aug2.0_426.1_20761.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_426.1_20761.t1 atggctgactttgacccttgtgagtgtgtgtggaaccatgaaaatgctatgcaaagacttattaacctgttgagaaacac ccagtcctactgcacagacaatgaatgtctcacggatttacctggttctgatacgacccctaactttggttttgactcgt tgatgttgatgatgctaggatgggctgtggtagctacagtactgtacctcgtcagacctaacagtctacgtaacagagga gatatgaaaccagccagaaataatgatcccagcccccctccacccggaccctcggtaaattga |
|
Protein
| Protein ID | pfu_aug2.0_426.1_20761.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_426.1_20761.t1 MADFDPCECVWNHENAMQRLINLLRNTQSYCTDNECLTDLPGSDTTPNFGFDSLMLMMLGWAVVATVLYLVRPNSLRNRG DMKPARNNDPSPPPPGPSVN |
|