Gene
| Gene Model ID | pfu_aug2.0_432.1_07516 |
|---|---|
| Locus | scaffold432.1 : 319759 ... 322925 : - |
| To GenomeBrowser | scaffold432.1:319759..322925 |
| Genes list of scaffold | scaffold432.1 |
| Synonym | pfu_aug1.0_5997.1_31106 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| aldo keto reductase | GO:0016491 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_432.1_07516.t1 | 1 | 1 | Aldo_ket_red | 17 | 99 | 2.4e-14 | 52.8 | 2.0e-18 | 3.0e-14 | 52.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_432.1_07516.t1 | gi|24215871|ref|NP_713352.1| | 9.0e-31 | |
| pfu_aug2.0_432.1_07516.t1 | gi|490921342|ref|WP_004783213.1| | glyoxal reductase [Leptospira kirschneri] | 3.0e-29 |
| pfu_aug2.0_432.1_07516.t1 | gi|515783197|ref|WP_017215656.1| | 2,5-diketo-D-gluconic acid reductase [Leptospira noguchii] | 4.0e-29 |
| pfu_aug2.0_432.1_07516.t1 | gi|657809778|ref|XP_008332181.1| | PREDICTED: prostaglandin F synthase-like [Cynoglossus semilaevis] | 3.0e-28 |
Transcript
| Transcript ID | pfu_aug2.0_432.1_07516.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_432.1_07516.t1 atgccggcttgctcaccccctctgtcaaccaaattgagctacaccctttactgcagagagaacgggatcgctgtgatggg ttactcccccatggccaagggacaaaaacttaaagatccaacactcgggaaaattgctcaaaaatataacaaaaccccgg cccaggttatgatccgttggagcgtccagatgggctttatcaccataccaaaatcagtcaacttagatcggatcattgag aatgcggatgtttttgattggtcgattgatgaagaggacatgaccacgctagatggtatgccagacgattcttgcacgtg gaatccttgtgaatcgccgtggaaaggatga |
|
Protein
| Protein ID | pfu_aug2.0_432.1_07516.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_432.1_07516.t1 MPACSPPLSTKLSYTLYCRENGIAVMGYSPMAKGQKLKDPTLGKIAQKYNKTPAQVMIRWSVQMGFITIPKSVNLDRIIE NADVFDWSIDEEDMTTLDGMPDDSCTWNPCESPWKG |
|