Gene
| Gene Model ID | pfu_aug2.0_450.1_00763 |
|---|---|
| Locus | scaffold450.1 : 299828 ... 308540 : - |
| To GenomeBrowser | scaffold450.1:299828..308540 |
| Genes list of scaffold | scaffold450.1 |
| Synonym | pfu_aug1.0_12075.1_17818 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| 28s ribosomal protein mitochondrial | GO:0005743 GO:0005763 GO:0044822 GO:0070124 GO:0070125 GO:0070126 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_450.1_00763.t1 | 2 | 1 | Ribosomal_S21 | 11 | 64 | 8.9e-10 | 37.8 | 1.8e-13 | 8.9e-10 | 37.8 |
| pfu_aug2.0_450.1_00763.t1 | 2 | 2 | Ribosomal_S21 | 69 | 80 | 8.9e-10 | 37.8 | 0.26 | 1300.0 | -1.1 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_450.1_00763.t1 | gi|13994257|ref|NP_114107.1| | 28S ribosomal protein S21, mitochondrial [Homo sapiens] | 8.0e-19 |
| pfu_aug2.0_450.1_00763.t1 | gi|585707935|ref|XP_006899185.1| | PREDICTED: 28S ribosomal protein S21, mitochondrial-like [Elephantulus edwardii] | 9.0e-19 |
| pfu_aug2.0_450.1_00763.t1 | gi|291398051|ref|XP_002715645.1| | PREDICTED: 28S ribosomal protein S21, mitochondrial [Oryctolagus cuniculus] | 1.0e-18 |
| pfu_aug2.0_450.1_00763.t1 | gi|332220141|ref|XP_003259216.1| | 1.0e-18 | |
| pfu_aug2.0_450.1_00763.t1 | gi|675881966|ref|XP_009026485.1| | hypothetical protein HELRODRAFT_86902 [Helobdella robusta] | 1.0e-18 |
Transcript
| Transcript ID | pfu_aug2.0_450.1_00763.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_450.1_00763.t1 atgacgaagcatctcaagttctttgcgaggactgttctcgtaaaggacaataatgtagcacaagcttatcaaaatctaca gaggtttctgagagaggagaaagtcataaaaaatgttgacatgcagacgtggttcagaagaccatatgagaaaagagtgc tgttatctatagccaggtgtaaacgaatctacaacagagaaatgaataagaaagtggaatttgctcttagaaagaacaga aaagatccatttccaagatga |
|
Protein
| Protein ID | pfu_aug2.0_450.1_00763.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_450.1_00763.t1 MTKHLKFFARTVLVKDNNVAQAYQNLQRFLREEKVIKNVDMQTWFRRPYEKRVLLSIARCKRIYNREMNKKVEFALRKNR KDPFPR |
|