Gene
| Gene Model ID | pfu_aug2.0_452.1_07545 |
|---|---|
| Locus | scaffold452.1 : 237721 ... 250373 : - |
| To GenomeBrowser | scaffold452.1:237721..250373 |
| Genes list of scaffold | scaffold452.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| udp-xylose and udp-n-acetylglucosamine transporter | GO:0005338 GO:0015711 GO:0015781 GO:0016020 GO:0055085 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_452.1_07545.t1 | 1 | 1 | UAA | 5 | 92 | 4.8e-18 | 65.1 | 3.6e-22 | 5.3e-18 | 64.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_452.1_07545.t1 | gi|632947406|ref|XP_007889029.1| | PREDICTED: UDP-xylose and UDP-N-acetylglucosamine transporter [Callorhinchus milii] | 6.0e-27 |
| pfu_aug2.0_452.1_07545.t1 | gi|390337575|ref|XP_781364.3| | 1.0e-25 | |
| pfu_aug2.0_452.1_07545.t1 | gi|742180801|ref|XP_010888063.1| | PREDICTED: UDP-xylose and UDP-N-acetylglucosamine transporter [Esox lucius] | 2.0e-24 |
| pfu_aug2.0_452.1_07545.t1 | gi|218505645|ref|NP_001136184.1| | UDP-xylose and UDP-N-acetylglucosamine transporter [Salmo salar] | 3.0e-24 |
| pfu_aug2.0_452.1_07545.t1 | gi|260799985|ref|XP_002594917.1| | hypothetical protein BRAFLDRAFT_209083 [Branchiostoma floridae] | 1.0e-23 |
Transcript
| Transcript ID | pfu_aug2.0_452.1_07545.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_452.1_07545.t1 atgatgatatggagtattggaatattgatgttagtagcacaacttttcctctcagctggcctgggaattttccaggagaa aacttatggcaaatatggtaaacacccaaaggaatctctgttttacaatcattttctacctctccctgggtttgtcttct tgatgtcagatatagcaaagcatgctcagttattatcacaaactgagccagtggagttagctttaggaatagctgtacca aagatgatcttattcctgattggaaatactctgactcatccaaaattttacctgtaa |
|
Protein
| Protein ID | pfu_aug2.0_452.1_07545.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_452.1_07545.t1 MMIWSIGILMLVAQLFLSAGLGIFQEKTYGKYGKHPKESLFYNHFLPLPGFVFLMSDIAKHAQLLSQTEPVELALGIAVP KMILFLIGNTLTHPKFYL |
|