Gene
| Gene Model ID | pfu_aug2.0_51.1_03510 |
|---|---|
| Locus | scaffold51.1 : 267919 ... 270078 : + |
| To GenomeBrowser | scaffold51.1:267919..270078 |
| Genes list of scaffold | scaffold51.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| proto-oncogene tyrosine-protein kinase receptor ret-like | GO:0004713 GO:0005524 GO:0018108 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_51.1_03510.t1 | 1 | 1 | Pkinase_Tyr | 1 | 46 | 8.1e-10 | 38.2 | 1.1e-13 | 8.1e-10 | 38.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_51.1_03510.t1 | gi|449684268|ref|XP_002158510.2| | 1.0e-14 | |
| pfu_aug2.0_51.1_03510.t1 | gi|449683132|ref|XP_004210274.1| | 6.0e-14 | |
| pfu_aug2.0_51.1_03510.t1 | gi|260803956|ref|XP_002596855.1| | hypothetical protein BRAFLDRAFT_237512 [Branchiostoma floridae] | 3.0e-13 |
Transcript
| Transcript ID | pfu_aug2.0_51.1_03510.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_51.1_03510.t1 atgaaggagatcggataccataagaacatcgttagtatgctgggctgctgtacgttacaggaccccgtatgtcttatagt tgaacatctacctcatggtgatctactcacatacctacgtaatataagacaactactacatgctacatcgaccataggtg gttggtatcggaaaaactcaagttttagtataaccacaacattgtttaaaaaatatgataaagatacaaaaagtatgcca aagattatggataacatggtttaa |
|
Protein
| Protein ID | pfu_aug2.0_51.1_03510.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_51.1_03510.t1 MKEIGYHKNIVSMLGCCTLQDPVCLIVEHLPHGDLLTYLRNIRQLLHATSTIGGWYRKNSSFSITTTLFKKYDKDTKSMP KIMDNMV |
|