Gene
| Gene Model ID | pfu_aug2.0_51.1_03516 |
|---|---|
| Locus | scaffold51.1 : 378078 ... 392502 : - |
| To GenomeBrowser | scaffold51.1:378078..392502 |
| Genes list of scaffold | scaffold51.1 |
| Synonym | pfu_aug1.0_2974.1_30307 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_51.1_03516.t1 | 2 | 1 | WD40 | 5 | 21 | 6.4e-17 | 60.7 | 4.4e-06 | 0.033 | 14.0 |
| pfu_aug2.0_51.1_03516.t1 | 2 | 2 | WD40 | 27 | 61 | 6.4e-17 | 60.7 | 6.0e-16 | 4.5e-12 | 45.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_51.1_03516.t1 | gi|585723217|ref|XP_006813605.1| | PREDICTED: mitochondrial division protein 1-like [Saccoglossus kowalevskii] | 3.0e-18 |
| pfu_aug2.0_51.1_03516.t1 | gi|115898433|ref|XP_001196195.1| | 3.0e-15 | |
| pfu_aug2.0_51.1_03516.t1 | gi|156392640|ref|XP_001636156.1| | predicted protein [Nematostella vectensis] | 3.0e-12 |
| pfu_aug2.0_51.1_03516.t1 | gi|459175547|ref|XP_004225960.1| | PREDICTED: F-box/WD repeat-containing protein 7-like [Ciona intestinalis] | 1.0e-11 |
| pfu_aug2.0_51.1_03516.t1 | gi|260803970|ref|XP_002596862.1| | hypothetical protein BRAFLDRAFT_99764 [Branchiostoma floridae] | 3.0e-11 |
Transcript
| Transcript ID | pfu_aug2.0_51.1_03516.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_51.1_03516.t1 atggttttccatagagggcgctttttcacagcttccggagacaacacagtgcgtgaatgggacttgctaacgatgaccag tgtccgaattctgcaaggacacaaagcacctgtaagagacgtcaaggtgtctaatgatcgaatcgtaacgtgcagcgacg acggcaccgtccggatttgggaccttttcgacagtagtaaagttttgaaacactga |
|
Protein
| Protein ID | pfu_aug2.0_51.1_03516.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_51.1_03516.t1 MVFHRGRFFTASGDNTVREWDLLTMTSVRILQGHKAPVRDVKVSNDRIVTCSDDGTVRIWDLFDSSKVLKH |
|