Gene
| Gene Model ID | pfu_aug2.0_517.1_24126 |
|---|---|
| Locus | scaffold517.1 : 196947 ... 198064 : + |
| To GenomeBrowser | scaffold517.1:196947..198064 |
| Genes list of scaffold | scaffold517.1 |
| Synonym | pfu_aug1.0_8994.1_02685 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| glutaredoxin 2 | GO:0001944 GO:0003147 GO:0005829 GO:0007417 GO:0009055 GO:0015035 GO:0045454 GO:0055114 GO:0080058 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_517.1_24126.t1 | 1 | 1 | Glutaredoxin | 2 | 42 | 3.2e-07 | 30.2 | 3.0e-11 | 4.5e-07 | 29.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_517.1_24126.t1 | gi|432855291|ref|XP_004068148.1| | PREDICTED: glutaredoxin 2 isoform X3 [Oryzias latipes] | 7.0e-19 |
| pfu_aug2.0_517.1_24126.t1 | gi|678008545|ref|XP_009080205.1| | PREDICTED: glutaredoxin 2 [Acanthisitta chloris] | 6.0e-18 |
| pfu_aug2.0_517.1_24126.t1 | gi|198433617|ref|XP_002125050.1| | PREDICTED: glutaredoxin-like [Ciona intestinalis] | 1.0e-17 |
| pfu_aug2.0_517.1_24126.t1 | gi|50539868|ref|NP_001002404.1| | glutaredoxin 2 [Danio rerio] | 1.0e-17 |
| pfu_aug2.0_517.1_24126.t1 | gi|528516262|ref|XP_005161792.1| | PREDICTED: glutaredoxin 2 isoform X3 [Danio rerio] | 1.0e-17 |
Transcript
| Transcript ID | pfu_aug2.0_517.1_24126.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_517.1_24126.t1 atgaaggtggatcaccatgtggtggagcttaaccatcatcccgagggctcggaaattcagagcgtgttagcagagatgac aaatgctagaactgttcctcgggtgttcatcaacggaatgtgtgtaggcggtgcttctgacatcaaatctctgtacaaga caggaaaactaatagatctagttaatgaatgtaacataacggcatcagatgttaaacaatga |
|
Protein
| Protein ID | pfu_aug2.0_517.1_24126.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_517.1_24126.t1 MKVDHHVVELNHHPEGSEIQSVLAEMTNARTVPRVFINGMCVGGASDIKSLYKTGKLIDLVNECNITASDVKQ |
|