Gene
| Gene Model ID | pfu_aug2.0_54.1_13489 |
|---|---|
| Locus | scaffold54.1 : 152654 ... 157845 : - |
| To GenomeBrowser | scaffold54.1:152654..157845 |
| Genes list of scaffold | scaffold54.1 |
| Synonym | pfu_aug1.0_25175.1_19060 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_54.1_13489.t1 | 1 | 1 | R3H | 9 | 62 | 7.3e-09 | 35.1 | 6.3e-13 | 9.4e-09 | 34.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_54.1_13489.t1 | gi|524869305|ref|XP_005091447.1| | PREDICTED: R3H domain-containing protein 4-like [Aplysia californica] | 3.0e-25 |
| pfu_aug2.0_54.1_13489.t1 | gi|556978784|ref|XP_005996398.1| | PREDICTED: R3H domain-containing protein 4 isoform X1 [Latimeria chalumnae] | 6.0e-23 |
| pfu_aug2.0_54.1_13489.t1 | gi|676462788|ref|XP_009056383.1| | hypothetical protein LOTGIDRAFT_239569 [Lottia gigantea] | 1.0e-22 |
| pfu_aug2.0_54.1_13489.t1 | gi|657544193|ref|XP_008277591.1| | PREDICTED: R3H domain-containing protein 4 [Stegastes partitus] | 8.0e-22 |
| pfu_aug2.0_54.1_13489.t1 | gi|617427419|ref|XP_007560627.1| | PREDICTED: R3H domain-containing protein 4 [Poecilia formosa] | 4.0e-21 |
Transcript
| Transcript ID | pfu_aug2.0_54.1_13489.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_54.1_13489.t1 atgcccttgggccttctgaaatgcttggaggatgaagtgacagcattcttccgggagtggccttcctctgtgtatgtatc agacctacaaactagctttgagaggatgaatttacatgcactatgtcagtatatggatctcaggtctcatagttatgatg aagatggcaatcgtcgtactcaggtcgagaatagacatcagcatttttgtcctccggctactctcctgacatcctaccta caaaaaggtggatcatcatga |
|
Protein
| Protein ID | pfu_aug2.0_54.1_13489.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_54.1_13489.t1 MPLGLLKCLEDEVTAFFREWPSSVYVSDLQTSFERMNLHALCQYMDLRSHSYDEDGNRRTQVENRHQHFCPPATLLTSYL QKGGSS |
|