Gene
| Gene Model ID | pfu_aug2.0_554.1_14302 |
|---|---|
| Locus | scaffold554.1 : 169994 ... 178983 : + |
| To GenomeBrowser | scaffold554.1:169994..178983 |
| Genes list of scaffold | scaffold554.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_554.1_14302.t1 | 1 | 1 | BolA | 5 | 61 | 7.2e-20 | 70.7 | 1.1e-23 | 8.5e-20 | 70.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_554.1_14302.t1 | gi|676466800|ref|XP_009057683.1| | hypothetical protein LOTGIDRAFT_122165, partial [Lottia gigantea] | 4.0e-27 |
| pfu_aug2.0_554.1_14302.t1 | gi|196010595|ref|XP_002115162.1| | hypothetical protein TRIADDRAFT_28548 [Trichoplax adhaerens] | 1.0e-24 |
| pfu_aug2.0_554.1_14302.t1 | gi|156351327|ref|XP_001622461.1| | predicted protein [Nematostella vectensis] | 2.0e-24 |
| pfu_aug2.0_554.1_14302.t1 | gi|240960498|ref|XP_002400558.1| | conserved hypothetical protein [Ixodes scapularis] | 2.0e-23 |
| pfu_aug2.0_554.1_14302.t1 | gi|665811242|ref|XP_008554080.1| | PREDICTED: bolA-like protein 2 [Microplitis demolitor] | 2.0e-23 |
Transcript
| Transcript ID | pfu_aug2.0_554.1_14302.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_554.1_14302.t1 atgtgtaaggcaatagaagacatgtccgatggctgtggatccaaatttcaagcgatcatcgtaactccaaaatttgaggg tgttccgttacttcagagacacagaatggttaactcatgtatagaggaggagatgaagtccatacacgcatttcagatga aaacctggacccctgaacaatgggagaaaaacaaaccaagctga |
|
Protein
| Protein ID | pfu_aug2.0_554.1_14302.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_554.1_14302.t1 MCKAIEDMSDGCGSKFQAIIVTPKFEGVPLLQRHRMVNSCIEEEMKSIHAFQMKTWTPEQWEKNKPS |
|