Gene
| Gene Model ID | pfu_aug2.0_563.1_10929 |
|---|---|
| Locus | scaffold563.1 : 66286 ... 68700 : + |
| To GenomeBrowser | scaffold563.1:66286..68700 |
| Genes list of scaffold | scaffold563.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_563.1_10929.t1 | 1 | 1 | Thioredoxin_2 | 27 | 120 | 8.8e-08 | 32.3 | 6.7e-11 | 1.2e-07 | 31.8 |
| pfu_aug2.0_563.1_10929.t1 | 1 | 1 | Thioredoxin_8 | 28 | 118 | 5.3e-25 | 87.3 | 4.1e-28 | 7.5e-25 | 86.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_563.1_10929.t1 | gi|156386901|ref|XP_001634149.1| | predicted protein [Nematostella vectensis] | 6.0e-28 |
| pfu_aug2.0_563.1_10929.t1 | gi|260821031|ref|XP_002605837.1| | hypothetical protein BRAFLDRAFT_84322 [Branchiostoma floridae] | 2.0e-25 |
| pfu_aug2.0_563.1_10929.t1 | gi|736240372|ref|XP_010784734.1| | PREDICTED: nucleoredoxin-like protein 2 [Notothenia coriiceps] | 3.0e-25 |
Transcript
| Transcript ID | pfu_aug2.0_563.1_10929.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_563.1_10929.t1 atgtcagcagtggttcgaaccctgggatttcagagtgtgtatggcaaggaaggatgggtggatttagaaaaggcactaca cggaaaatattcaggtttgtactttgctggtatttggtgtccgccttgtagagattttacagtaattctacgagaatttt acgagttattcaaagataagatagagatcatcttcatcagctgggactatgaagaagaggactacatagataattacaaa gatatgccatggcttgcattaccatatagcgagagagaaatcaaggatagactttgtgtcaaatatgacgtcattggtac accaaggttagtggttctccgggaggatgctaccgtggtaacacttaacgccaggaagcaacttcttgacgacaatttga atttccccgccaattggtcacgtggtgaaattggacgccgtgatcactga |
|
Protein
| Protein ID | pfu_aug2.0_563.1_10929.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_563.1_10929.t1 MSAVVRTLGFQSVYGKEGWVDLEKALHGKYSGLYFAGIWCPPCRDFTVILREFYELFKDKIEIIFISWDYEEEDYIDNYK DMPWLALPYSEREIKDRLCVKYDVIGTPRLVVLREDATVVTLNARKQLLDDNLNFPANWSRGEIGRRDH |
|