Gene
| Gene Model ID | pfu_aug2.0_621.1_04408 |
|---|---|
| Locus | scaffold621.1 : 242124 ... 267579 : + |
| To GenomeBrowser | scaffold621.1:242124..267579 |
| Genes list of scaffold | scaffold621.1 |
| Synonym | pfu_aug1.0_1201.1_07833 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| probable small nuclear ribonucleoprotein g | GO:0019013 GO:0030529 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_621.1_04408.t1 | 1 | 1 | LSM | 8 | 70 | 4.1e-19 | 67.9 | 3.1e-23 | 4.5e-19 | 67.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_621.1_04408.t1 | gi|383851818|ref|XP_003701428.1| | PREDICTED: probable small nuclear ribonucleoprotein G isoform X1 [Megachile rotundata] | 3.0e-38 |
| pfu_aug2.0_621.1_04408.t1 | gi|746868453|ref|XP_011065356.1| | PREDICTED: probable small nuclear ribonucleoprotein G [Acromyrmex echinatior] | 3.0e-38 |
| pfu_aug2.0_621.1_04408.t1 | gi|759064203|ref|XP_011341497.1| | PREDICTED: probable small nuclear ribonucleoprotein G [Cerapachys biroi] | 5.0e-38 |
| pfu_aug2.0_621.1_04408.t1 | gi|751202962|ref|XP_011174382.1| | PREDICTED: probable small nuclear ribonucleoprotein G [Solenopsis invicta] | 6.0e-38 |
| pfu_aug2.0_621.1_04408.t1 | gi|340725441|ref|XP_003401078.1| | PREDICTED: probable small nuclear ribonucleoprotein G [Bombus terrestris] | 6.0e-38 |
Transcript
| Transcript ID | pfu_aug2.0_621.1_04408.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_621.1_04408.t1 atgagcaaagcacacccaccagaattgaaaaagtacatggagaagagaataaacttaaagctaaatggcggcagacaaat acagggaatccttcgaggatttgacccgttcatgaatctcgtagttgatgaaagcatagaggaaacaaagcttggtgaaa agaacacaatcggaatggtggtggtacgaggaaacagcataattctgttagaagctttagatcgcatcggataa |
|
Protein
| Protein ID | pfu_aug2.0_621.1_04408.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_621.1_04408.t1 MSKAHPPELKKYMEKRINLKLNGGRQIQGILRGFDPFMNLVVDESIEETKLGEKNTIGMVVVRGNSIILLEALDRIG |
|