Gene
| Gene Model ID | pfu_aug2.0_64.1_13513 |
|---|---|
| Locus | scaffold64.1 : 180380 ... 187335 : - |
| To GenomeBrowser | scaffold64.1:180380..187335 |
| Genes list of scaffold | scaffold64.1 |
| Synonym | pfu_aug1.0_1562.1_22653 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| iron-sulfur cluster assembly enzyme mitochondrial | GO:0005506 GO:0016226 GO:0051536 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_64.1_13513.t1 | 1 | 1 | NifU_N | 2 | 121 | 0.0 | 178.1 | 0.0 | 0.0 | 177.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_64.1_13513.t1 | gi|676480998|ref|XP_009062235.1| | hypothetical protein LOTGIDRAFT_210679 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_64.1_13513.t1 | gi|524879487|ref|XP_005096418.1| | PREDICTED: iron-sulfur cluster assembly enzyme ISCU, mitochondrial-like [Aplysia californica] | 0.0 |
| pfu_aug2.0_64.1_13513.t1 | gi|751210967|ref|XP_011158205.1| | PREDICTED: iron-sulfur cluster assembly enzyme ISCU, mitochondrial [Solenopsis invicta] | 0.0 |
| pfu_aug2.0_64.1_13513.t1 | gi|512933054|ref|XP_004932696.1| | PREDICTED: iron-sulfur cluster assembly enzyme ISCU, mitochondrial [Bombyx mori] | 0.0 |
| pfu_aug2.0_64.1_13513.t1 | gi|755923293|ref|XP_011313816.1| | PREDICTED: iron-sulfur cluster assembly enzyme ISCU, mitochondrial [Fopius arisanus] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_64.1_13513.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_64.1_13513.t1 atggttattgatcattatgagaatcccagaaatgttggatctcttgacaagaaggataaatctgtgggtactggactggt gggagctccagcatgtggcgacgtcatgaaactacagataaaagttgatgacagtggtaaaattgttgatgccaagttta aaactttcggctgtggatccgccatagcatcaagttcattggctacagaatgggtgaaaggaaagtcagttgatgaagcc attaaaatcaagaatacagatattgcaaaggaactgtgcttgcctcctgtgaaactacattgctccatgctggcagagga tgcaattaaagcagcgctcaaagacttcaagatcaaaaaccagtccatgcagacggcagctgcagtcgattaa |
|
Protein
| Protein ID | pfu_aug2.0_64.1_13513.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_64.1_13513.t1 MVIDHYENPRNVGSLDKKDKSVGTGLVGAPACGDVMKLQIKVDDSGKIVDAKFKTFGCGSAIASSSLATEWVKGKSVDEA IKIKNTDIAKELCLPPVKLHCSMLAEDAIKAALKDFKIKNQSMQTAAAVD |
|