Gene
| Gene Model ID | pfu_aug2.0_694.1_14470 |
|---|---|
| Locus | scaffold694.1 : 56426 ... 60324 : + |
| To GenomeBrowser | scaffold694.1:56426..60324 |
| Genes list of scaffold | scaffold694.1 |
| Synonym | pfu_aug1.0_7588.1_09593 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| transmembrane protein 258 | GO:0016021 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_694.1_14470.t1 | 1 | 1 | UPF0197 | 7 | 83 | 3.39955e-42 | 142.5 | 2.8026e-45 | 3.89981e-42 | 142.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_694.1_14470.t1 | gi|676487639|ref|XP_009064362.1| | hypothetical protein LOTGIDRAFT_196219 [Lottia gigantea] | 6.99949e-42 |
| pfu_aug2.0_694.1_14470.t1 | gi|524884077|ref|XP_005098662.1| | PREDICTED: transmembrane protein 258-like isoform X1 [Aplysia californica] | 1.99993e-41 |
| pfu_aug2.0_694.1_14470.t1 | gi|390342716|ref|XP_003725720.1| | 1.0e-39 | |
| pfu_aug2.0_694.1_14470.t1 | gi|7656934|ref|NP_055021.1| | transmembrane protein 258 [Homo sapiens] | 4.0e-39 |
| pfu_aug2.0_694.1_14470.t1 | gi|318055947|ref|NP_001187759.1| | NEF1 protein [Ictalurus punctatus] | 4.0e-39 |
Transcript
| Transcript ID | pfu_aug2.0_694.1_14470.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_694.1_14470.t1 atggctagcagtatgtcaatcgagtctatgaacagatatgtcagccccatcaacccggcagtgtttccacatcttactgt tgtactactagggataggcatcttcttcatggcatggttctttgtatatgaagtaacatcgaataaattcactcgtgatc tgttcaaggaattgattgtttcattggtagcttccgtctttatgggatttggagttgtctttcttttattatgggctggc atctatgtatag |
|
Protein
| Protein ID | pfu_aug2.0_694.1_14470.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_694.1_14470.t1 MASSMSIESMNRYVSPINPAVFPHLTVVLLGIGIFFMAWFFVYEVTSNKFTRDLFKELIVSLVASVFMGFGVVFLLLWAG IYV |
|