Gene
Gene Model ID | pfu_aug2.0_715.1_17753 |
---|---|
Locus | scaffold715.1 : 16953 ... 24625 : - |
To GenomeBrowser | scaffold715.1:16953..24625 |
Genes list of scaffold | scaffold715.1 |
Synonym | pfu_aug1.0_5436.1_01993 |
Manual annotation
Annotation by Blast2GO
Annotation | GO |
---|---|
40s ribosomal protein s4 | GO:0003735 GO:0005840 GO:0006412 GO:0019843 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug2.0_715.1_17753.t1 | 2 | 1 | S4 | 47 | 93 | 3.6e-07 | 29.5 | 1.5e-10 | 7.6e-07 | 28.4 |
pfu_aug2.0_715.1_17753.t1 | 2 | 1 | Ribosomal_S4e | 60 | 72 | 5.5e-31 | 106.0 | 1.0 | 5100.0 | -2.8 |
pfu_aug2.0_715.1_17753.t1 | 2 | 2 | Ribosomal_S4e | 97 | 172 | 5.5e-31 | 106.0 | 1.2e-34 | 6.0e-31 | 105.9 |
pfu_aug2.0_715.1_17753.t1 | 2 | 2 | S4 | 157 | 161 | 3.6e-07 | 29.5 | 1.2 | 6100.0 | -3.3 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug2.0_715.1_17753.t1 | gi|241710443|ref|XP_002413398.1| | 40S ribosomal protein S4, putative [Ixodes scapularis] | 0.0 |
pfu_aug2.0_715.1_17753.t1 | gi|585701851|ref|XP_006822958.1| | PREDICTED: 40S ribosomal protein S4, X isoform-like [Saccoglossus kowalevskii] | 0.0 |
pfu_aug2.0_715.1_17753.t1 | gi|524901464|ref|XP_005107139.1| | PREDICTED: 40S ribosomal protein S4-like [Aplysia californica] | 0.0 |
pfu_aug2.0_715.1_17753.t1 | gi|260808562|ref|XP_002599076.1| | hypothetical protein BRAFLDRAFT_81739 [Branchiostoma floridae] | 0.0 |
pfu_aug2.0_715.1_17753.t1 | gi|557780154|ref|XP_005189699.1| | PREDICTED: 40S ribosomal protein S4 [Musca domestica] | 0.0 |
Transcript
Transcript ID | pfu_aug2.0_715.1_17753.t1 |
---|---|
Definition | - |
>pfu_aug2.0_715.1_17753.t1 atgaaaagcaaagatgtactttcttcatacataaaaatgcgcatcaacgtgatgtttgcttcactcattctaaatggacc tatatttctcgctccaaagcccagcactggtccccacaaatccagggaatctctgccactgattctcttcctgaggaaca gactaaagtacgctttgacatatgatgaagttaccaaaattgtgatgcagagattaataaaggttgacggaaaagtcagg actgacaaaacctacccagctggttttatggatgttatcactattgaaaagacagcagaaaacttccgactcttgtacga cgttaaaggcagattcacaatccacaggattaagcccgaggaagctaaatacaaattatgccgcgtgaggaaagtagcat gtgggccaaaaggagttccctatatcacaacacatgatgccagaaccatcagatatcctgatcctctagtaaaggtcaat gacaccatcatggttgacattgcctcaggaaaaatcaaggatttcatcaagtttgattcagctttcagctatacaaaatg a |
Protein
Protein ID | pfu_aug2.0_715.1_17753.t1 |
---|---|
Definition | - |
>pfu_aug2.0_715.1_17753.t1 MKSKDVLSSYIKMRINVMFASLILNGPIFLAPKPSTGPHKSRESLPLILFLRNRLKYALTYDEVTKIVMQRLIKVDGKVR TDKTYPAGFMDVITIEKTAENFRLLYDVKGRFTIHRIKPEEAKYKLCRVRKVACGPKGVPYITTHDARTIRYPDPLVKVN DTIMVDIASGKIKDFIKFDSAFSYTK |