Gene
| Gene Model ID | pfu_aug2.0_805.1_17841 |
|---|---|
| Locus | scaffold805.1 : 1 ... 5005 : - |
| To GenomeBrowser | scaffold805.1:1..5005 |
| Genes list of scaffold | scaffold805.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| cysteine-rich pdz-binding protein | GO:0005737 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_805.1_17841.t1 | 1 | 1 | Cript | 41 | 103 | 1.0e-22 | 80.2 | 5.3e-26 | 1.1e-22 | 80.1 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_805.1_17841.t1 | gi|676486200|ref|XP_009063899.1| | hypothetical protein LOTGIDRAFT_229474 [Lottia gigantea] | 6.0e-28 |
| pfu_aug2.0_805.1_17841.t1 | gi|291224717|ref|XP_002732348.1| | PREDICTED: cysteine-rich PDZ-binding protein-like [Saccoglossus kowalevskii] | 3.0e-26 |
| pfu_aug2.0_805.1_17841.t1 | gi|675858004|ref|XP_009014562.1| | hypothetical protein HELRODRAFT_156728 [Helobdella robusta] | 2.0e-24 |
| pfu_aug2.0_805.1_17841.t1 | gi|260831428|ref|XP_002610661.1| | hypothetical protein BRAFLDRAFT_113645 [Branchiostoma floridae] | 4.0e-24 |
| pfu_aug2.0_805.1_17841.t1 | gi|585177886|ref|XP_006740669.1| | PREDICTED: GTPase ERas-like [Leptonychotes weddellii] | 6.0e-24 |
Transcript
| Transcript ID | pfu_aug2.0_805.1_17841.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_805.1_17841.t1 atggtagacactaccagtaaatacagagtactgttagacatggtagacactagcagtaaatacagaatactggtagacac tagcagtaaatacagagtactggtagacatggtagacactagcagtaaaaacagagtactggtagacatatttgctccct accagtccttttcaaaatgtaggatatgtaaatcatcagtacatcagtctgggtcacattattgtcaaggatgtgcatac aaaaaaggtatatgtgctatgtgtgggaagaagataatagaaacaaaggactacagacagacctcagtgtga |
|
Protein
| Protein ID | pfu_aug2.0_805.1_17841.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_805.1_17841.t1 MVDTTSKYRVLLDMVDTSSKYRILVDTSSKYRVLVDMVDTSSKNRVLVDIFAPYQSFSKCRICKSSVHQSGSHYCQGCAY KKGICAMCGKKIIETKDYRQTSV |
|