Gene
| Gene Model ID | pfu_aug2.0_846.1_21207 |
|---|---|
| Locus | scaffold846.1 : 101866 ... 124770 : + |
| To GenomeBrowser | scaffold846.1:101866..124770 |
| Genes list of scaffold | scaffold846.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_846.1_21207.t1 | 1 | 1 | I-set | 28 | 107 | 1.7e-10 | 40.6 | 8.4e-14 | 2.1e-10 | 40.3 |
| pfu_aug2.0_846.1_21207.t1 | 1 | 1 | Ig_2 | 33 | 114 | 1.1e-08 | 35.0 | 6.8e-12 | 1.7e-08 | 34.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_846.1_21207.t1 | gi|676489069|ref|XP_009064817.1| | hypothetical protein LOTGIDRAFT_168677 [Lottia gigantea] | 3.0e-40 |
| pfu_aug2.0_846.1_21207.t1 | gi|524888416|ref|XP_005100779.1| | PREDICTED: inactive tyrosine-protein kinase 7-like [Aplysia californica] | 9.0e-18 |
| pfu_aug2.0_846.1_21207.t1 | gi|675888822|ref|XP_009029913.1| | hypothetical protein HELRODRAFT_181885 [Helobdella robusta] | 2.0e-17 |
| pfu_aug2.0_846.1_21207.t1 | gi|675868840|ref|XP_009019980.1| | hypothetical protein HELRODRAFT_106742 [Helobdella robusta] | 8.0e-17 |
| pfu_aug2.0_846.1_21207.t1 | gi|742107838|ref|XP_010871354.1| | PREDICTED: inactive tyrosine-protein kinase 7 [Esox lucius] | 2.0e-16 |
Transcript
| Transcript ID | pfu_aug2.0_846.1_21207.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_846.1_21207.t1 atggctgtgcagacgagatgtttagtcgtgattttatttattttctgtacagtttcacagacagcgtgtcaggataattt ctacttcagttctaaacccgaaaacagagacgttgtggagggcagtgaaatagtgttgtactgtgatgtttccaatagga accaaattgccttcagttggatacagtctggtaaagctataaagacttctagtagaaagtttcaggagggacgaaattta aggattctcagggtgaccagagacgaggacaaggggccatttcagtgtattgctaccaactatacatccggatactcaac acaaagcaacgaggcgctcttgaacatacaatagaaccttgcaacttttggatattga |
|
Protein
| Protein ID | pfu_aug2.0_846.1_21207.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_846.1_21207.t1 MAVQTRCLVVILFIFCTVSQTACQDNFYFSSKPENRDVVEGSEIVLYCDVSNRNQIAFSWIQSGKAIKTSSRKFQEGRNL RILRVTRDEDKGPFQCIATNYTSGYSTQSNEALLNIQXNLATFGY |
|