Gene
| Gene Model ID | pfu_aug2.0_97.1_23453 |
|---|---|
| Locus | scaffold97.1 : 499687 ... 503177 : + |
| To GenomeBrowser | scaffold97.1:499687..503177 |
| Genes list of scaffold | scaffold97.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| asparagine synthetase domain-containing protein 1 isoform x2 | GO:0004066 GO:0006529 GO:0006541 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_97.1_23453.t1 | 1 | 1 | Asn_synthase | 1 | 70 | 6.4e-19 | 68.4 | 4.9e-23 | 7.3e-19 | 68.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_97.1_23453.t1 | gi|260823756|ref|XP_002606834.1| | hypothetical protein BRAFLDRAFT_103566 [Branchiostoma floridae] | 0.0 |
| pfu_aug2.0_97.1_23453.t1 | gi|731243854|ref|XP_010635145.1| | PREDICTED: asparagine synthetase domain-containing protein 1 isoform X2 [Fukomys damarensis] | 0.0 |
| pfu_aug2.0_97.1_23453.t1 | gi|676421731|ref|XP_009043846.1| | hypothetical protein LOTGIDRAFT_181114 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_97.1_23453.t1 | gi|694897752|ref|XP_009442141.1| | PREDICTED: asparagine synthetase domain-containing protein 1 isoform X4 [Pan troglodytes] | 0.0 |
| pfu_aug2.0_97.1_23453.t1 | gi|731243852|ref|XP_010635144.1| | PREDICTED: asparagine synthetase domain-containing protein 1 isoform X1 [Fukomys damarensis] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_97.1_23453.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_97.1_23453.t1 atggaggtattgaggatatctgccaggaatctgggtagagatgatagaattataacagaccatggtaaagaatccagatt tccattcctggatgaaaatgttgttgcttttcttcaaaaccttcctatccaccacaaggccaatctgaatctgcccagag gattgggtgagaagttactcttgcgattggcagcaacaaagtgtggattaataaacacggctgttttccctaaacgtgcc attcagtttggatctagaattgcaaagattgaaaacagcaaagagaaagctagtgataaatgtacaagacttgcagagta a |
|
Protein
| Protein ID | pfu_aug2.0_97.1_23453.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_97.1_23453.t1 MEVLRISARNLGRDDRIITDHGKESRFPFLDENVVAFLQNLPIHHKANLNLPRGLGEKLLLRLAATKCGLINTAVFPKRA IQFGSRIAKIENSKEKASDKCTRLAE |
|